Cilp1 antibody

Author: avce

August undefined, 2024

WebNov 18, 2008 · The synthesis of cartilage intermediate layer protein (CILP), which was identified and purified from human articular cartilage ( Lorenzo et al., 1998 ), increases in early osteoarthrosis cartilage. By RT-PCR using human articular cartilage RNA and degenerate primers based on the amino acid sequence of CILP, and by screening a … WebListed below are anti-CILP-1 antibodies from multiple suppliers. CILP-1 is a reported alias name for the human gene CILP, or 'cartilage intermediate layer protein'. The 1184-amino acid protein has a reported mass of 132,565 daltons. The cellular localization is predicted to be secreted. Glycosylation sites have been reported.

Cartilage Intermediate Layer Protein 2 (CILP-2) Is Expressed in ...

WebThe CILP-1 (cartilage intermediate-layer protein 1) gene product is a 132 kDa (predicted) monomeric glycoprotein that is found in both hyaline and fibrocartilage. It is a precursor for two secreted, … WebBoster Bio Anti-CILP1 Antibody catalog # A06239. Tested in ELISA, WB applications. This antibody reacts with Human. Supplied as 100ul in Liquid form antibody. Anti-CILP1 … philosopher\\u0027s o5

(A06239) Anti-CILP1 Antibody (A06239) - Boster …

WebCD74, also known as CLIP, is a 33.5kD homotrimer and functions as a MHC class II chaperone for exogenous peptides and other MHC class II molecules. CD74 binds MIF and regulates innate and adaptive immunity through CD44 signaling. It is found primarily on B-cells, monocytes, macrophages and dendritic WebHuman CILP-1 N-Terminal Fragment Biotinylated Antibody. Cat # BAF5504. Human URB Antibody. Cat # AF3410. Citations (1) Recombinant Human Protocadherin gamma C3 Protein, CF. ... (CILP1): A novel mediator of cardiac extracellular matrix remodelling Authors: FA van Nieuwe, C Munts, RC Op't Veld, A González, J Díez, S Heymans, B ... WebPresident Trump commented on the possibility of a "COVID 4" relief bill and his desire to invest in the country's infrastructure. philosopher\u0027s o5

CILP-1 Antibody [Unconjugated] (AF5504): Novus Biologicals

Human CILP-1 N-Terminal Fragment Antibody - Bio-Techne

WebJan 15, 2024 · Background. CILP, Cartilage Intermediate Layer Protein, is specifically expressed in the articular cartilage intermediate layer (it cannot be found in the … WebCILP-1 is a pro-form of two polypeptides, and is cleaved into distinct N- and C-terminal fragments at a furin endoprotease consensussite(7).TheN-terminalofCILP-1hasbeenshownto bind to and inhibit TGF 1in vitro(8), andCILP1mRNA is induced by TGF 1 (9). tshipi investmentWebThis product is a recombinant monoclonal antibody, which offers several advantages including: - High batch-to-batch consistency and reproducibility - Improved sensitivity and … tshipi merchants

"WebMar 21, 2024 · CILP (Cartilage Intermediate Layer Protein) is a Protein Coding gene. Diseases associated with CILP include Intervertebral Disc Disease and Osteoarthritis . … " - Cilp1 antibody

Cilp1 antibody

Recombinant Anti-CILP antibody [EPR16303] - BSA and Azide free …

WebAntibody Testing Data (2) Application FIGURE 1/2 CLP1 Antibody (14746-1-AP) in WB Mouse testis tissue were subjected to SDS PAGE followed by western blot with 14746-1 … WebThis product is a recombinant monoclonal antibody, which offers several advantages including: - High batch-to-batch consistency and reproducibility - Improved sensitivity and specificity - Long-term security of supply - Animal-free …

Did you know?

WebOct 6, 2024 · Rationale: Cartilage intermediate layer protein 1 (Cilp1) is a secreted extracellular matrix (ECM) protein normally associated with bone and cartilage development. Its function and mechanism of... WebAntibody [NBP1-81667] CILP-1 Antibody by Novus Biologicals. Menu Sign in or Register Search; Custom Suppliers; Data; Citations; Images; Listing; Contact; ... O75339 - …

WebThe CILP-1 (cartilage intermediate-layer protein 1) gene product is a 132 kDa (predicted) monomeric glycoprotein that is found in both hyaline and fibrocartilage. It is a precursor for two secreted, proteolytically generated products, a 90 kDa N-terminal CILP-1, and a 62 kDa C-terminal NTPPHase-homolog. WebBackground: CILP-1 The CILP-1 (cartilage intermediate-layer protein 1) gene product is a monomeric glycoprotein precursor of two secreted, proteolytically generated products, a 90 kDa N-terminal CILP-1, and a 62 kDa C-terminal NTPPHase-homolog. It is found in both hyaline and fibrocartilage.

WebProduct Details. This Human CILP ELISA Kit was designed for the quantitative measurement of Human CILP protein in serum, plasma, tissue homogenates. It is a … WebThe CILP-1 (cartilage intermediate-layer protein 1) gene product is a 132 kDa (predicted) monomeric glycoprotein that is found in both hyaline and fibrocartilage. It is a precursor …

WebJun 1, 2024 · Cilp1 polyclonal antibody was raised in rabbits against a synthetic peptide (RQTMLAQSVRRVQPVKRTPKTLAKPADSQE) corresponding to preproCILP1 22-51, after conjugating with keyhole limpet hemocyanin via its C-terminal cysteine. Antibodies for immunofluorescence staining of 4′, 6-diamidino-2-phenylindole (DAPI) and alpha-smooth …

WebDetector antibody conjugate. Biotin. Label or dye. HRP . Gene aliases. CILP, CILP-1, HsT18872, UNQ602/PRO1188. Gene ID (Human) 8483. Gene symbol. CILP. UniProt ID (Human) O75339. Show Less . About This Kit. Human CILP-1 quantitates human CILP-1 in serum, plasma, supernatant. The assay will exclusively recognize both natural and … tshiping water user associationWeb(A06239) Anti-CILP1 Antibody (A06239) Supplier Boster Biological Technology. Host Rabbit View Product On Supplier's Website. Add to Procurement List Product is on your procurement list. View List. Remove. View more details on the supplier's website. Supplier provided information. Validations. None provided. Applications. tshipi in englishWebJun 1, 2005 · Background. CILP, Cartilage Intermediate Layer Protein, is specifically expressed in the articular cartilage intermediate layer (it cannot be found in the superficial nor in the deepest layers) and is involved in scaffolding. Overexpression of this protein … philosopher\\u0027s o6WebThis product is a recombinant monoclonal antibody, which offers several advantages including: - High batch-to-batch consistency and reproducibility - Improved sensitivity and specificity - Long-term security of supply - Animal-free … philosopher\u0027s o3WebBackground. Cytoplasmic FMR1-interacting protein 1 (CYFIP1) is a component of the CYFIP1/EIF4E/FMR1 complex which mediates translational repression by binding … tshipinare primary schoolWeb(A06239) Anti-CILP1 Antibody (A06239) Supplier Boster Biological Technology. Host Rabbit View Product On Supplier's Website. Add to Procurement List Product is on your … philosopher\u0027s o2WebOct 8, 2024 · In mice, the amount of RV CILP1 was markedly higher after banding than after sham. Control patients had lower CILP1 serum levels than all other groups (p<0.001). CILP1 concentrations were higher in PH patients with maladaptive RV function than those with adaptive RV function (p<0.001), LV pressure overload (p<0.001), and DCM (p=0.003). tshipi training center